BrowseRankingCreatemarriage and sword Novel
and closed the door quickly behind him. He sighed and walked slowly to the bed where he lied down for a while. He closed his eyes and tried to visualize the sword dance that Zander did on his wedding
Read Nowand scandals. He knows it all. But did he ever says anything about it? No. Why? Because he simply don't care anymore-- Actually he cares, otherwise he wouldn't caught them-- Aphrodite and Ares--
Read Nowand Mrs. Gu exchanged a look with each other, not knowing what was happening. As she mentioned that, Madame Gu showed a smile on her face. "The officer of the Ministry of Revenue and his wife will be
Read Nowand became motionless. His blood colored the entire ground. Everyone froze. The Imperial Palace fell into a terrifying silence. Qin Yuan, the youngest son of the king of Qin, came to the Liu Kingdom
Read Nowmarriage agreement fell through…" As their grandfathers were close with one another, they had heartily decided to betroth the grandchildren to one another. However, with the death of his grandfather,
ROMANCEACTIONADVENTUREREINCARNATIONCOMEDYSYSTEMHAREMCULTIVATIONWEAKTOSTRONGOVERPOWEREDTRANSMIGRATIONVIDEOGAMEACADEMYHIGHIQFACESLAPPINGFASTPACEDUNPRINCIPLEDMULTIPLELEADSORDINARYDOCTORRead Nowmarriage? This was the Dragon King's daughter—Ao Yinzhu of the Thousand Stream Seas' Colored Glass Palace—and the kind of person she was wasn't a secret. Her beauty was naturally at the top and her a
Read Nowand she could not accept the new change of plans. This girl did not want to follow through with the bet, yet she was willing to give her life for it. Although it could be that she was temporarily
ADVENTURESYSTEMCULTIVATIONWEAKTOSTRONGTRANSMIGRATIONVIDEOGAMELEVELUPMYTHIMMORTALUNPRINCIPLEDORDINARYRead Nowand crimson eyes. Aslan's upper body was naked and he had only the bottom of an armor. Aslan waved his sword with agility and precision. In 3 years of training, Aslan began to develop a style of fenc
Read Nowand Half-saint Liuli stood side by side right at the front. They were Huang Yanchen's parents, but they were actually not expected to come out and receive Zhang Ruochen since they were the elders of t
Read Nowand swimming pool. This was a high-end private club. Also, a high-end banquet venue. Lan Family, second to Qin Family in Rivertown, was indeed a billion-dollar group. Even though the stock price of
Read Nowmarriage? Realizing that he had lost himself in the moment, Luo Xuanqing forced himself to calm down before replying quietly, "There are some things that you aren't qualified to know given your curre
Read Nowand saying worriedly, "Ye Mo, how are you? Are you okay?" "I'm fine." Seeing what was happening before him, Yun Feng was infuriated as he shouted in anger, "Chuchu, how can you treat an outsider li
Read Now
I GOT CHEAT ABILITY IN A DIFFERENT WORLD, EVEN IN THE REAL WORLD
by RenConcreto3.34 (Not enough ratings)and the forest brought a lot of resources and benefits to the Regal Kingdom. At the same time, this forest was known throughout the world as one of the dangerous zones. The danger level was lowe
Read Nowand gratitude. "Old blind man, you are a peerless strong, but we don't know why you are willing to protect us, ordinary people, from generation to generation. Although we know that you don't like u
Read NowPernikahan. Aku benar-benar membenci kata-kata itu, lebih baik aku tidak pernah menikah daripada harus menikah dengan laki-laki aneh sepertimu. - Gianina Leteshia Tenanglah, mungil. Kau akan jatuh
Read Nowand stubborn. Faced with a dilemma as Hokuto refuses to take her swordsmanship training seriously, her father uses up his only favor with a mysterious expert, the number one sword user in the land - t
Read Nowand need to forge a path for yourself. Our protagonist was suddenly struck with a very good luck that granted him two paths to tread. That of the.... SWORD AND BLOODLINE.
Read Nowmarriage or an engagement of marriage is to be considered legal in the Celestial Domain, then it must be registered in the Temple of Love. And Marriage Certificates are issued by it. Therefore any
Read Now- Read Now
and as those water made way through the chiseled handsome face and then through the neck whose veins seems to be bulging and those hot abs... Readers: Ahem ..... While Aaron was bathing he saw a sil
Read Nowand treatment by Imperial Physician, Crown Prince meridian broke off and the root bone shattered. I am afraid that if he wakes up, he is a waste person. On Imperial Throne, Huangfu Yunshan clenched
Read Nowsword was made out of ordinary wood, but the young teenager wielding it had unwavering will burning in his right eye. He was breathing rapidly, as he looked at the beauty in front of him. The woman wh
Read Nowand Shanaria , was overjoyed with their crown prince Rudra's marriage preparations. The Shrine where the marriage was going to happen , was decorated with various flowers and the lamps. The shrine wa
Read Nowand three girls. I think father is making certain that there is an heir and a spare (and a few spares for both the heir and the spare). I remember when I figured out my role in this world, as the futu
Read Nowand three girls. I think father is making certain that there is an heir and a spare (and a few spares for both the heir and the spare). I remember when I figured out my role in this world, as the futu
Read Nowand up the waterfall, but he didn't quite make it there. Just a little further, but not quite there yet. I had just completed my run when I suddenly caught sight of someone waiting for me right next
Read Nowand masked. The marriage partner was the man right in front of me. KASSIAN : "Long time no see." Kassian's shameless and smirky smiley face wasn't a good match. In the meantime, Arne wa
Read Nowand has been the mighty ruler of the entire continent. Selena was a daughter of the King and a random maid .The king had over 3 wives and multiple maids. Selena was the only Daughter of the King but s
Read Now
![Hephaestus Chronicles [ In Redevelopment ] Marriage And Sword Novel](https://img.webnovel.com/bookcover/19330404405018905/180/180.jpg "Hephaestus Chronicles [ In Redevelopment ] [Marriage And Sword Novel]")
![[HIATUS]A Princess Is dead,A Necromancer Is Born Marriage And Sword Novel](https://img.webnovel.com/bookcover/18310315806304905/180/180.jpg "[HIATUS]A Princess Is dead,A Necromancer Is Born [Marriage And Sword Novel]")
People search marriage and sword also like:
