BrowseRankingCreatebattle through the heavens Novel
battle, and this turn of events had caught them completely off guard. "Th… they ran just like that?" "God An forced all the Wind Demons into retreat with one sword strike! Bad*ss!" "Student An Lin,
Read Nowbattle maniacs. As his body began to rise into the air, suddenly, his arm felt weak and was no longer able to support his body's weight. Peng! He fell back down to the ground. Ye Tian Yun fell into
Read Nowheavens and the earth. This kind of groundbreaking technique was something that Ling Chuxi had never felt before. Ling Chuxi was ecstatic as she focused on the finger gesture. It felt like under the
Read Nowbattle situation became increasingly intense. More and more of his opponents appeared, surrounding him as though crashing tides. He fought on just like that, as though a madman. Behind him was a magn
ROMANCEADVENTUREREINCARNATIONCOMEDYHAREMCULTIVATIONWEAKTOSTRONGCONQUERBEAUTYRAREBLOODLINEUNPRINCIPLEDMULTIPLELEADSPREGNANCYELVESAVENTURAREENCARNACINRead Nowbattle and even helped his rival promote his novel for two days. People on Longshan Forum were still talking about it. Heaven Xiao opened Fengyun and went to the page for "Battle Through the Heavens"
Read Nowheavens, the founder of Qin Palace was said to be someone at the Renhuang level, and the Overbearing Style had been started at Qin Palace. Xing Sen was also extraordinary. He had cultivated his flesh
Read NowIn a land where no magic is present. A land where the strong make the rules and the weak have to obey. A land filled with alluring treasures and beauty, yet also filled with unforeseen danger. Three y
Read Nowbattle platform and peered imperiously downwards at the crowd. Apparently, he had no notions of leaving the Cloudheaven Arena and wanted to continue battling. "Who can go kill him?" In the location w
ROMANCEACTIONADVENTUREHAREMCULTIVATIONWEAKTOSTRONGMYSTERYREVENGEBEAUTYBETRAYALDEVILGENIUSMYTHACADEMYIMMORTALRAREBLOODLINEBEASTTAMINGRead Nowbattle technique as well. It was a conceptualization that he had come up with through his epiphany, so it was not too difficult for him to materialize it into a battle technique. Sentimental humans
ROMANCEACTIONADVENTUREREINCARNATIONCOMEDYSYSTEMHAREMCULTIVATIONWEAKTOSTRONGOVERPOWEREDTRANSMIGRATIONVIDEOGAMEACADEMYHIGHIQFACESLAPPINGFASTPACEDUNPRINCIPLEDMULTIPLELEADSORDINARYDOCTORRead Nowbattle ax cleaved down as immense divine might surged through the nine firmaments, tearing apart the Chaos Heavens' membrane and rushing into the void of the universe. The massive divine strength was
ROMANCEACTIONADVENTUREREINCARNATIONMAGICCULTIVATIONWEAKTOSTRONGTRANSMIGRATIONNONHUMANCONQUERBEAUTYDEVILRAREBLOODLINERead Nowbattle this time will be extremely treacherous!" The faces of these eight people instantly turned grim. Then, they all moved aside and remained silent. This was clear: they were waiting for Jun Moxi
ROMANCEACTIONADVENTUREREINCARNATIONCOMEDYHAREMMAGICCULTIVATIONWEAKTOSTRONGTRANSMIGRATIONNONHUMANCONQUERBEAUTYGENIUSROYALFAMILYMULTIPLELEADSDOCTORRead Nowbattle. While that was happening, the people who had followed Thunderous Battle into the second level of the crystal mine just concentrated on digging. When Blood River Sect split up to attack them,
Read Nowbattle in the sea! One battle to decide everything, the victors would be crowned kings, while the losers vilified!" "Once this news spread out, the entire world was shocked! However, for those of the
Read Nowbattle between supreme-level human immortal palaces and two emperor-level immortal palaces in Woods Medium-sized Domain and the fierce contradictions between immortal generals being affected by Golden
Read Nowbattle technique as well. It was a conceptualization that he had come up with through his epiphany, so it was not too difficult for him to materialize it into a battle technique. Sentimental humans
Read Nowbattle is now turning dangerous because of the interference of the Will of the World. But he constructed a new plan the moment the Will of the World comes into play. But…. he needs time for his plan
Read Nowbattle methodology that contained extremely strong plethoric sword methods. He was wowed just by the name of the methodology. But he didn't fully understand the words that were written below it. H
Read Nowbattle strength would be maimed, and they'd never again be able to fight directly against the Nine Heavens. Few in the Heavenly Realm had no grudges with Tian, but most who did had already pledged th
Read Nowbattle situation in the Heavens Ball. However, as the Heavens Ball's space covered over 100,000 square miles, it could not be fully manifested in the mirage at the same time. Therefore, the mirage onl
Read Now- Read Now
This is a Battle Through The Heavens fan fic.
Read Nowbattle methodology that contained extremely strong plethoric sword methods. He was wowed just by the name of the methodology. But he didn't fully understand the words that were written below it. H
Read Now
People search battle through the heavens also like:
