ed and randall true story

Journey To Become A True God

Ye Chen was an honest and hardworking man, but he caught his girlfriend who was having an affair with a wealthy second generation, because of his sadness he decided to return to his hometown to calm down, while on his way he met a god cultivator and ended up being his student . After that his life began to change, on the right and left arms holding the Beautiful girl, from the start of the School flower, rich young women, beautiful teachers, beauty Ceo, famous beauty stars, beautiful goddesses. one by one the women came to him

DarkForces · Eastern

True Martial World

With the strongest experts from the 33 Skies the Human Emperor, Lin Ming, and his opponent, the Abyssal Demon King, were embroiled in a final battle. In the end, the Human Emperor destroyed the Abyssal World and killed the Abyssal Demon King. By then, a godly artifact, the mysterious purple card that had previously sealed the Abyssal Demon King, had long since disappeared into the space-time vortex, tunneling through infinite spacetime together with one of Lin Ming’s loved ones. In the vast wilderness, where martial arts was still slowly growing in its infancy, several peerless masters tried to find their path in the world of martial arts. A young adult named Yi Yun from modern Earth unwittingly stumbles into such a world and begins his journey with a purple card of unknown origin. This is a magnificent yet unknown true martial world! This is the story of a normal young adult and his adventures!!

Cocooned Cow · Eastern

The Fake Heiress Turns Out to Be a True Tycoon!

After being kicked out by her family, she turned out the real heiress worth billions, and people around her got to know it. Her family regretted deeply and demanded half of her fortune as repayment for bringing her up. She sneered and used a truth-telling talisman to expose their plots. A scumbag had always been pestering her and wanted to get back together. She easily made him "meet his ancestors" every night. Moreover, her cousins had looked down on her, regarding her as a disgrace. Surprisingly, the chairman of a rich family came to her and said, "As long as you can save my daughter, I'll meet all your demands!" Another rich family, who had been at feud with her new family for a long time, also shamelessly came over and said, "As long as you can help us, our family will be very grateful for the kindness of your family!" Later, even the rebellious cousin became her follower, claiming, "She is my only sister! Whoever dares to insult her, I will curse their entire family!" Her new family finally realized that their little poor girl was actually a big shot! "I need to draw spells, get rid of evils, save people and chase that guy! How busy I am!" She said in distress. That guy, "Actually, you don't need to chase me. I'm already yours."

LittleFishOnKitty · Urban

The True Heiress Is The Real Bigshot

Former bigshot, Ying Zijin, woke up one day as the lost daughter of the Ying family, who had been missing for fifteen years. The Ying family promptly adopted another child to replace her. Upon returning to the wealthy family, everyone mocked her for not being as clever, capable, sensible, and elegant as a fake heiress. Her parents considered her a stain on the family and warned her not to harbor any illusions of being a lady of the family. They said she should be grateful for being a foster daughter, or else they would send her away. Ying Zijin: "I'll leave then. No need to see me off." While the Ying family celebrated joyously and others waited to see the real heiress make a fool of herself, influential figures from various fields took action. The top-rated idol with the most influential fans said, "Miss Ying, just let me know if you need anything." The heir to a global economic monopoly said, "Ying family? What's that? Boss, should we just wipe them out?" The number one martial artist in the country asked, "Who dares to bully my master?" The genius teenage boy with an IQ of 228 said, "That's my sister." A man with an incredibly seductive appearance smirked lazily and casually, saying, "Sure, then call me brother-in-law." The influential figures were confused. When the real heiress' true identity was restored, it caused a sensation on the internet. The Ying family went crazy and knelt, crying and begging her to come back. The international powerhouse family said, "Sorry, let me introduce her. This is our real heiress." Reborn as a king, making a strong comeback and launching a counterattack!

Qing Qian · General

Related Reviews

Chaos_Factory

2020-06-20

This is the most ****ed up story I've read and honestly it's funny a true novel for laughs and anything you can think of it's just really ****ed up to the point it's funny and hilarious I would write more but then it's just not my style.

That Time I Got Isekai’d To Another World With My Truck!!

RantCafe · Fantasy

26 Chs

Talaya_Robles

2019-11-03

Gfjcrycdygfrthfdsvnsynwynrmeygmehmrhmdmemevmd md dhmehmdhm Ed mdndhmdh Smzhmhz Bc this was a true gift to the world I love this book and all the characters.

The Bumpy Road of Marriage: Divorce Now, Daddy

Bean Ding Ding · Urban

3566 Chs

_jessitayylor

2022-07-04

First chapter won me already! Leo and Randall's friendship is the best. Almost like anime bros. They are written well and it's definitely a plot not common with the others.

Hide Me, Mister Billionaire!

Kyrie_Sunbae · Urban

195 Chs

rose270709

2019-03-11

Thank you for sharing this story to us. I like the story even on it's time to time detour.. it's still amazed me how the Ed. It's true that's it's more on realistic and romantic.good job!

I Just Can't Say Goodbye

gents46 · Urban

242 Chs

Hellan_White

2021-08-04

Wow!!! A fantasy synopsis! I really love it! The World created by the author felt so real and felt I'm inside it because of the way the author narrates it. I love Randall😍. This story has great potential and All the best for your work Author ☺️🤟🏻

False Loneliness

NakhariSong · Fantasy

15 Chs

Taoist priest, times have changed

A piece of treasure coin brought Yun Song to a great era that was surging with wind and surging clouds. Here, there were foreigners with strong ships and cannons, warlords and factions everywhere, rich people living in luxury, and people displaced. Here, there were also monsters, evil spirits, python immortals, dragon corpses, living tombs, dead jade, paper figurines stealing lives, stone Buddhas buying luck, old cats worshiping the moon at night, wild foxes stealing coffins, ancient towns sending messengers of death every day, old villages in the old capital, ten miles of foreign fields filled with haunted houses, white bone temples hidden in thousands of people's pits, and thousand-year-old demons appearing frequently in nameless cities. Here, there were two sides to the treasure money. The money was used by humans, and the money was used by ghosts. The Cloud Pine had two sides. It was a Taoist priest in Taoist robes, a lonely soul, a ghost, a zombie, an evil Buddha, and a wild city god… PS： This book is also known as " I thought I was a Taoist priest, but I turned out to be a ghost?" " You thought I was a ghost, but I'm a bunch of ghosts!"

Full metal shell

· 4K Views

The world has entered the era of great navigation

When they woke up, all the humans in the world were teleported to the Great Voyage World. Transcendents, murlocs, castles on the sea… Pirates, secret arts, the Evil God of the Deep Sea… Fishing, strange items, bronze sailboat… Zhou Lei used the time artifact to return to the beginning of the teleportation and once again stepped into the magnificent Great Voyage Era.

Xiao Shichu

· 7.1K Views

Counterattack begins with an open plot

Yechen, let's go home, okay?" " Home? I don't have a home. All of this is just a conspiracy!" "Are you really going to give up on me…?" The flower bloomed and withered for a thousand years. Everyone thought that the Red Spider Lily was the flower of death. Who would have thought that she was so beautiful just because she was waiting for someone's ten miles of red makeup…!

ink signature

· 3.3K Views

[Mythical Martial Arts: Starting from Jinyiwei]

[Wulin Express: Huashan Sword Contest: One Solar Finger pointing at the mountain, Hong Qigong's divine dragon protecting his body, and Huang Yaoshi summoning the wind and rain.] Wang Chongyang opened the Heavenly Gate with a single sword strike, shattered his Fated Star, and became a martial arts legend. North Winds Peak was slandered as a Khitan bastard. In a fit of anger, he broke the Yellow River and destroyed the Yanmen Pass. Nan Murong guided the stars and cultivated the ancient phenomenon, Boundless Star Domain. The Five Mountains Sword Sect attacked the Black Wood Cliff. Invincible East took out his treasure, the Splendid Landscape Map, and killed all the experts of the Five Mountains. Looking at the dazzling tabloid news in her hand, Ye Jun found it unbelievable,[Is this a f * cking martial arts world?] Fortunately, there was the Stats Picking System. God Thief brushed past you, and you picked up the dropped attributes of "God Trapping Finger" and "Quick Hand Attribute x10". You defeated Ding Xiu and picked up "Attribute Points x 20". You can add any points you want. You dug out Rama's body and picked up Rama Internal Strength. Shi Potian has become your sworn brother. You have picked up the dropped attributes of Enlightenment x100 and Luck x100. You found Dugu Qiubai's tomb and picked up the "Dugu Sword Scripture" You picked up the True Dragon's Blood that Hong Qigong dropped during the Sword Contest on Mount Hua. You picked up the ancient phenomenon "Blue Sea Shining Blue Sky" that Medicine Master Huang dropped. Until one day, when Ye Jun had countless True Spirit blood and countless ancient phenomena above her head, she realized that she was invincible in the human world.

I'm not a man

· 6.1K Views

Master's Manual

In 1668, my city was rated as the safest area in the country. I made an indelible contribution to this. Because I was caught.

Tingri

· 5K Views